Huayue Pharmaceutical Co., Ltd.
Sincere, professional and good quality
Select Language
English
Home Other Peptide Somatotropin Drugs

Sermorelin

Browse Categories
Contact Us
Ms. Li
27F WT Center,6 HK M.Rd.,Qingdao China
I am Online Chat Now

Sermorelin

Payment & Shipping Terms:
Minimum Order Quantity: 1 kit
Packaging Details: standard
Delivery Time: within a week
Payment Terms: Wester Union,Moneygarms
Supply Ability: 100000mg/month
Description
Catalog Number L648976
Certified Level HPLC Certified
Mass Spectrum Certified
Unit size 2 mg/vial
Unit Quantity 1 Vial
Total Weight 2 mg
CAS NO. 86168-78-7
Synonyms Sermorelin Acetate
Molecular Formula C149H246N44O42S
Molecular Weight 3357.88
Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Appearance White Powder
Purity >98%(HPLC)
Identity (ESI-MS) 3357.88±4.0
Source Chemical Synthesis
Bacterial Endotoxins < 5EU/mg
Test Parameter Standard
Solubility Soluble in water or 1% acetic acid
Storage Lyophilized SERMORELIN although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.
Reports:
M120630-L648976 98.21% MS HPLC
M121006-L648976 98.71% MS HPLC
Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino acid polypeptide that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It is used as a test for growth hormone secretion and often used extensively in anti-aging therapy in conjunction with testosterone in men.
 

 

Hot seller Products list::

Kigtropin 10iu

Jintropin 10iu

HGH 10iu

IGF-1LR3 100mcg

IGF DES 1mg

CJC1295 without DAC 2mg

CJC1295 with DAC 2mg

GHRP-2 5mg

GHRP-6 5mg

HCG 5000 iu

Hexarelin 2mg

HGH Frag 176/191 2mg

Ipamorelin 2mg

Melanotan I 10mg

Mgf 2mg

Peg-mgf 2mg

PT-141 10mg

Sermorelin 2mg

Thymosin β4 2mg

EPO 3000 iu

Tesamorelin 2mg

 

 

 

Contact Us
Ms. Li
  • 86-010-85668888-218
  • 27F WT Center,6 HK M.Rd.,Qingdao China
From:
Enter your Email ID please.
Send your inquiry directly to us
(75/3000)